- DLL4 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-86413
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- Immunohistochemistry, Immunohistochemistry-Paraffin
- 0.1 ml (also 25ul)
- Unconjugated
- AOS6, delta4, hdelta2
- DLL4
- This antibody was developed against Recombinant Protein corresponding to amino acids: CHDLENGLMC TCPAGFSGRR CEVRTSIDAC ASSPCFNRAT CYTDLSTDTF VCNCPYGFVG SRCEFPVGL
- Human
- delta like canonical Notch ligand 4
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Neuroscience
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
CHDLENGLMCTCPAGFSGRRCEVRTSIDACASSPCFNRATCYTDLSTDTFVCNCPYGFVGSRCEFPVGL
Specifications/Features
Available conjugates: Unconjugated